PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48895.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 381aa    MW: 43021.7 Da    PI: 4.7168
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48895.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
       KHN48895.1 16 RGPWSPAEDLKLIAFIQKYGHENWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding53.46.1e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++k lG++ W++Ia+ ++ gRt++++k+ w+++l
       KHN48895.1  69 RGNFTPEEEETIIRLHKALGNK-WSKIASGLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-24766IPR009057Homeodomain-like
PROSITE profilePS5129414.151163IPR017930Myb domain
SuperFamilySSF466891.09E-2914110IPR009057Homeodomain-like
SMARTSM007173.5E-131565IPR001005SANT/Myb domain
PfamPF002491.8E-141663IPR001005SANT/Myb domain
CDDcd001671.27E-91863No hitNo description
PROSITE profilePS5129425.39264118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-2767118IPR009057Homeodomain-like
SMARTSM007172.3E-1568116IPR001005SANT/Myb domain
PfamPF002491.6E-1569114IPR001005SANT/Myb domain
CDDcd001671.81E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGKGRAPCCD KTQVKRGPWS PAEDLKLIAF IQKYGHENWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFTPEEEETI IRLHKALGNK WSKIASGLPG RTDNEIKNVW NTHLKKRLAP  120
KKVSESSADE SKPESSITSS SSSSSESFFS NERPNSPKTT TPSNNEFNDQ AEKLSVEDKM  180
DKDSEKQLSN ELVNITEDPK ESSVSLSSVE SNIVNTSQIV EHKPEEEQLA SPLPYLGHYD  240
VGSILEEVDK PNHLIEIPWE PDYDFWKLLD DDNSLGSFQS NEVQLGEFPA IQNIILGEEG  300
VHDAEAKKWS HDFENEFGVV GGIKESSKDH FLPKNYAVEP EMGHTQAFDF DDIDMARPES  360
ELDFGYIQLW PSCPQNNNTS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27161187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006598214.10.0PREDICTED: LOW QUALITY PROTEIN: myb-related protein Zm1
TrEMBLA0A0B2SVL80.0A0A0B2SVL8_GLYSO; Myb-related protein Zm1
STRINGGLYMA08G17861.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100293042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.12e-80myb domain protein 63
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]